PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g028390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 679aa    MW: 75139.9 Da    PI: 7.1005
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g028390.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-094825142254
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       ++yp+ +++  LA+++gLt +qV++WF N R +
  Sopen11g028390.1 482 HPYPTDSDKHMLASQTGLTRNQVSNWFINARVR 514
                       89*****************************87 PP

2BELL101.28e-33335400772
              BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +kkakL+ ++ee++krYkqy++q+q+v+ssFe+vagl +a+pY+slAlk++++hF++L++ i++++
  Sopen11g028390.1 335 QKKAKLIFMQEEICKRYKQYHQQMQMVVSSFETVAGLSAATPYISLALKTVAQHFKSLRNTITDHL 400
                       79************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.4E-45253398IPR006563POX domain
PfamPF075265.1E-38258397IPR006563POX domain
PROSITE profilePS5007111.904455518IPR001356Homeobox domain
SMARTSM003892.9E-9458522IPR001356Homeobox domain
CDDcd000862.46E-11458519No hitNo description
SuperFamilySSF466897.27E-17460524IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28461522IPR009057Homeodomain-like
PfamPF059206.4E-18475514IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MSDQVSEFHV AQHSRRERLR ITSSEELDII HQYGNISYDP SVVLSSSEMI NFATTTTGTT  60
DVAQNCSNWR SLQHSSCGWN NVTNFNSSGS VIETNNYLSP MFVGGEGGVL SGSLNLNSST  120
IDVKPNFYGG FNEMHQSIPD TITSNAEFSS SVLYHDTLQE VVKSATKGNQ RVDSWIENES  180
YVDQSRHLYD KNCGLGTNLR TNVSDNSSAQ GLALSLSPVP RTNTMQMEKR NNVMVPENFA  240
IAQRSAVPLG PFTGYATILK SSQFLRPAQQ LLDELCDLAA GSSNVIKCSN FSKKVRDGFR  300
VSCDVNAAES SSGGGGGVGD SSGLNESNVC PEYLQKKAKL IFMQEEICKR YKQYHQQMQM  360
VVSSFETVAG LSAATPYISL ALKTVAQHFK SLRNTITDHL KNIRQALGED LPSPASGMSN  420
KGDGNSSRLK FVDQTSLHKQ KSGSTAGVAF LESQQHVWRP QRGLPERAVA ILRAWLFDHF  480
LHPYPTDSDK HMLASQTGLT RNQVSNWFIN ARVRVWKPMV EEIHMLETKG GDQTRKSDVN  540
KLVTERTNHV NCGQHLSNVL LNMSGVAMPE KQEICHGGIG PSERLDESSS DHHMWRNQEK  600
RSRIECHHIS DGSSMDGSLM GFVPYQRNGL EIGGNIGAVS LTLGLRQNAE AAQQQQQLQL  660
HEHRLRQQFG GHIIHDFVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16464521158Homeobox protein Meis1
4xrs_B1e-16464521158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057350.10.0PREDICTED: BEL1-like homeodomain protein 8
TrEMBLM1AE490.0M1AE49_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000208250.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-84BEL1-like homeodomain 8